PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000223G1160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 584aa    MW: 62258.6 Da    PI: 8.1113
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000223G1160genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.9e-103603971954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+  +++ LA+++gLt +qV++WF N R +
  PH01000223G1160 360 FEHflHPYPTDGDKQMLARQTGLTRNQVSNWFINARVR 397
                      554459******************************88 PP

2BELL94.78.2e-31228297372
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +e q kk++L+s++eeV+krY+qy++q+q+vi+sFe+vag  +a+p++++Al+a+++hF+cLk +i +q+
  PH01000223G1160 228 AEQQWKKTRLISMMEEVCKRYRQYYQQVQAVIASFETVAGFSNAAPFAAMALRAMAKHFKCLKGMILNQL 297
                      5899**************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.3E-37160295IPR006563POX domain
PfamPF075263.3E-37165293IPR006563POX domain
PROSITE profilePS5007112.228338401IPR001356Homeobox domain
SMARTSM003899.5E-11341405IPR001356Homeobox domain
CDDcd000863.03E-13341402No hitNo description
SuperFamilySSF466894.71E-17343410IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28344405IPR009057Homeodomain-like
PfamPF059201.1E-18358397IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MSSAAGGYGG RAGSGAEPHG HGHGHAHGHL LLQHHAQHVA GAAAGGQLYH VPQHSRREKL  60
RFPPDAADSP PPPPAPQQHP GGWPPPPFYS YASSSSSYSP HSPTLAQTQL VAHGLAAPLT  120
QIPTQNFSLS LSSASSNPPP PPRRQFGGPA PATGPYGPFT GYAAVLGRSR FLGPAQKLLE  180
EICDVGGTAA HVDRSVPDEG LLGGDPMDGA DAVDHDLDAA DAGPISGAEQ QWKKTRLISM  240
MEEVCKRYRQ YYQQVQAVIA SFETVAGFSN AAPFAAMALR AMAKHFKCLK GMILNQLRNT  300
SKIAVKEGLN KDIAMFGLAG GSAGLQGGNN VSAFGQPHNI WRPQRGLPER AVSVLRAWLF  360
EHFLHPYPTD GDKQMLARQT GLTRNQVSNW FINARVRLWK PMVEEIHNLE MRQMHKHSAI  420
DKSQHGMHHQ AQHSSQCSGK PSDPSDSQPG QSSSITRNHN TPGSQSFPDE LSQMSHSIPG  480
QVSFAYNGLS TQHSIGSSQH QQVGGVWVGV GGAGNGGVSL TLGLHQDNRV CIADPLPATL  540
PPNLAHRFGL EDVNDAYVMG SFGGQDRHFA KEIGGHLLHD FVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A8e-17347405563Homeobox protein Meis2
4xrm_B8e-17347405563Homeobox protein Meis2
4xrs_A6e-17347404158Homeobox protein Meis1
4xrs_B6e-17347404158Homeobox protein Meis1
5bng_A6e-17347405159Homeobox protein Meis2
5bng_B6e-17347405159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688150.10.0PREDICTED: BEL1-like homeodomain protein 9, partial
TrEMBLJ3L5U30.0J3L5U3_ORYBR; Uncharacterized protein
STRINGOB01G45990.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-54BEL1-like homeodomain 8